PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g02960.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 438aa    MW: 47076.5 Da    PI: 7.0407
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g02960.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.2e-2469112245
                             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                      epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Zjn_sc00014.1.g02960.1.sm.mkhc  69 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 112
                                     69***************************************986 PP

2QLQ54.82.8e-19642137
                             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                    ++FT++Q+ +L++Q+l++KyLaan  +P++Ll +i++
  Zjn_sc00014.1.g02960.1.sm.mkhc  6 GPFTPSQWIELEHQALIFKYLAANSRIPHNLLIPIRR 42
                                    59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.2E-10642IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.9E-14741IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.736742IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.6568112IPR014977WRC domain
PfamPF088793.4E-2070111IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MARMRGPFTP SQWIELEHQA LIFKYLAANS RIPHNLLIPI RRSLASAYFG TSTLGWGSFQ  60
LGYSGNADLE PGRCRRTDGK KWRCSRDAVA DQKYCERHMN RGRHRSRKHV EGQPGHAAKA  120
MSEAVVAAAA SATQPGVLAA SGAGATAAGL AVNQHQQPVK NYGAGASDPC SLQYNSELMT  180
KQNQSENIQE SDNLSVLTSM NSRNNGSTFS FSKQNNPFEV TNSRPDFGLV SSESLMNSPH  240
SSLENINLLS SQSVSERQSS ASLQHFVDWP RTPAQGGIAW PDAEDIQAPR TQLSVSAPMA  300
SSELSSASTS PIHEKLILSP LKLSREYSPV GLSISANRDE AGQVQGNWML RSMGGPLGEV  360
LTKNGNAEAM NCMSAPLNLF SDCWDTSLGL DSSPVGVLQK TTFGSISSST GSSPMMENYS  420
GYDGICNPQD DLGSIVIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A0A9TSP30.0A0A0A9TSP3_ARUDO; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.13e-54growth-regulating factor 1